
                                  banana 



Wiki

   The master copies of EMBOSS documentation are available at
   http://emboss.open-bio.org/wiki/Appdocs on the EMBOSS Wiki.

   Please help by correcting and extending the Wiki pages.

Function

   Plot bending and curvature data for B-DNA

Description

   banana predicts bending of a normal (B) DNA double helix, using the
   method of Goodsell & Dickerson, NAR 1994 11;22(24):5497-5503. The
   program calculates the magnitude of local bending and macroscopic
   curvature at each point along an arbitrary B-DNA sequence, using any
   desired bending model that specifies values of twist, roll and tilt as
   a function of sequence. The program outputs both a graphical display
   and a text file of the results.

   The default model (model 'a' from the Goodsell & Dickerson paper) is
   based on the nucleosome positioning data of Satchwell et al 1986 (J.
   Mol. Biol. 191, 659-675). It correctly predicts experimental A-tract
   curvature as measured by gel retardation and cyclization kinetics and
   successfully predicts curvature in regions containing phased GGGCCC
   sequences. The model shows local bending at mixed sequence DNA, strong
   bends at the sequence GGC, and straight, rigid A-tracts. It is the
   only model out of the six investigated that is consistent with both
   solution data from gel retardation and cyclization kinetics and
   structural data from x-ray crystallography.

Algorithm

   banana reads a sequence and a matrix of standard twist, roll and tilt
   angles for each type of base pair step. The default matrix is
   described below (see "Bending Model") but some other can be specified
   (see "Data Files" below). The program creates a table or a graphical
   image of the bending and the curvature at each base step.

   The indicated twist, roll and tilt angles are applied at each step
   along the sequence, and the resulting base pair normal vector
   calculated. The first base pair is aligned normal to the z axis, with
   a twist value of 0.0 degrees. The specified twist is applied to the
   second base pair, and roll and tilt values are use to calculate its
   normal vector relative to the first. If either roll or tilt is
   non-zero, the new normal vector will be angled away from the z axis,
   producing the first 'bend'. The process is continued along the
   sequence, applying the appropriate twist, roll and tilt to each new
   base pair relative to its predecessor. The result is a list of normal
   vectors for all base pairs in the sequence.

   Local bends are then calculated from the normal vectors. The bend for
   base N is calculated across a window from N-1 to N+1.

   Curvature is calculated in two steps. Base pair normals are first
   averaged over a 10-base-pair window to filter out the local writhing
   of the helix. The normals of the nine base pairs from N-4 to N+4, and
   the two base pairs N-5 and N+5 at half weight, are averaged and
   assigned to base pair N. Curvature then is calculated from these
   averaged normal vector values, using a bracket value, nc, with a value
   of 15. That is, the curvature at base pair N is the angle between
   averaged normal vectors at base pairs N-nc and N+nc.

  Bending Model

   banana reads by default a data file (Eangles_tri.dat) of twist, roll
   and tilt angles, as in Goodsell & Dickerson, NAR 1994
   11;22(24):5497-503 and Drew and Travers (1986) JMB 191, 659. The
   roll-tilt-twist parameters of this bending model are objective and
   unbiased. They are derived purely from experimental observations of
   sequence location preferences of base trimers in small circles of DNA,
   without reference to solution techniques that measure curvature per
   se.

   Satchwell, Drew and Travers studied the positioning of DNA sequences
   wrappped around nucleosome cores, and in closed circles of
   double-helical DNA of comparable size. From the sequence data they
   calculated a fractional preference of each base pair triplet for a
   position 'facing out', or with the major groove on the concave side of
   the curved helix.

   The sequence GGC, for example, has a 45% preference for locations on a
   bent double helix in which its major groove faces inward and is
   compressed by the curvature (tending towards positive roll), whereas
   sequence AAA has a 36% preference for the opposite orientation, with
   major groove facing outward and with minor groove facing inward and
   compressed (tending toward negative roll).

   These fractional variances are converted into roll angles in the
   following manner: Because x-ray cyrstal structure analysis uniformly
   indicates that AA steps are unbent, a zero roll is assigned to the AAA
   triplet; an arbitrary maximum roll of 10 degrees is asigned to GGC,
   and all other triplets are scaled in a lenear manner. Where % is the
   percent-out figure, then: Roll = 10 degrees * (% + 36)/(45 + 36)

   Changing the maximum roll value will scale the entire profile up or
   down proportionately, but will not change the shape of the profile.
   Peaks will remain peaks, and valleys, valleys. The absolute magnitude
   of all the roll values is less important than their relative
   magnitude, or the order of roll preference. Twist angles were set to
   zero. Because these values correspond to base trimers, the values of
   roll, tilt and twist were applied to the first two bases for the
   calculation.

Usage

   Here is a sample session with banana


% banana -nooutfile -graph ps 
Plot bending and curvature data for B-DNA
Input nucleotide sequence: tembl:u68037

Created banana.ps

   Go to the input files for this example
   Go to the output files for this example

   Example 2


% banana -graph data 
Plot bending and curvature data for B-DNA
Input nucleotide sequence: tembl:u68037

Created banana1.dat
Created banana2.dat
Created banana3.dat
Created banana4.dat
Created banana5.dat
Created banana6.dat
Created banana7.dat
Created banana8.dat
Created banana9.dat

   Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequence]          sequence   Nucleotide sequence filename and optional
                                  format, or reference (input USA)
   -graph              graph      [$EMBOSS_GRAPHICS value, or x11] Graph type
                                  (ps, hpgl, hp7470, hp7580, meta, cps, x11,
                                  tekt, tek, none, data, das, xterm, png, gif)

   Additional (Optional) qualifiers:
   -anglesfile         datafile   [Eangles_tri.dat] DNA base timer roll angles
                                  data file
   -residuesperline    integer    [50] Number of residues to be displayed on
                                  each line (Any integer value)
   -outfile            outfile    [banana.profile] Output file name

   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-sequence" associated qualifiers
   -sbegin1            integer    Start of the sequence to be used
   -send1              integer    End of the sequence to be used
   -sreverse1          boolean    Reverse (if DNA)
   -sask1              boolean    Ask for begin/end/reverse
   -snucleotide1       boolean    Sequence is nucleotide
   -sprotein1          boolean    Sequence is protein
   -slower1            boolean    Make lower case
   -supper1            boolean    Make upper case
   -sformat1           string     Input sequence format
   -sdbname1           string     Database name
   -sid1               string     Entryname
   -ufo1               string     UFO features
   -fformat1           string     Features format
   -fopenfile1         string     Features file name

   "-graph" associated qualifiers
   -gprompt            boolean    Graph prompting
   -gdesc              string     Graph description
   -gtitle             string     Graph title
   -gsubtitle          string     Graph subtitle
   -gxtitle            string     Graph x axis title
   -gytitle            string     Graph y axis title
   -goutfile           string     Output file for non interactive displays
   -gdirectory         string     Output directory

   "-outfile" associated qualifiers
   -odirectory         string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write first file to standard output
   -filter             boolean    Read first file from standard input, write
                                  first file to standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report dying program messages

Input file format

   Any DNA sequence USA.

  Input files for usage example

   'tembl:u68037' is a sequence entry in the example nucleic acid
   database 'tembl'

  Database entry: tembl:u68037

ID   U68037; SV 1; linear; mRNA; STD; ROD; 1218 BP.
XX
AC   U68037;
XX
DT   23-SEP-1996 (Rel. 49, Created)
DT   04-MAR-2000 (Rel. 63, Last updated, Version 2)
XX
DE   Rattus norvegicus EP1 prostanoid receptor mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia
;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Rattus.
XX
RN   [1]
RP   1-1218
RA   Abramovitz M., Boie Y.;
RT   "Cloning of the rat EP1 prostanoid receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-1218
RA   Abramovitz M., Boie Y.;
RT   ;
RL   Submitted (26-AUG-1996) to the EMBL/GenBank/DDBJ databases.
RL   Biochemistry & Molecular Biology, Merck Frosst Center for Therapeutic
RL   Research, P. O. Box 1005, Pointe Claire - Dorval, Quebec H9R 4P8, Canada
XX
DR   ASTD; TRAN00000010928.
DR   Ensembl-Gn; ENSRNOG00000004094; Rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000005470; Rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1218
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS             1..1218
FT                   /codon_start=1
FT                   /product="EP1 prostanoid receptor"
FT                   /note="family 1 G-protein coupled receptor"
FT                   /db_xref="GOA:P70597"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70597"
FT                   /protein_id="AAB07735.1"
FT                   /translation="MSPYGLNLSLVDEATTCVTPRVPNTSVVLPTGGNGTSPALPIFS
M
FT                   TLGAVSNVLALALLAQVAGRLRRRRSTATFLLFVASLLAIDLAGHVIPGALVLRLYTA
G
FT                   RAPAGGACHFLGGCMVFFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAL
L
FT                   AAMALAVALLPLVHVGHYELQYPGTWCFISLGPPGGWRQALLAGLFAGLGLAALLAAL
V
FT                   CNTLSGLALLRARWRRRRSRRFRENAGPDDRRRWGSRGLRLASASSASSITSTTAALR
S
FT                   SRGGGSARRVHAHDVEMVGQLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLA
V
FT                   RLASWNQILDPWVYILLRQAMLRQLLRLLPLRVSAKGGPTELSLTKSAWEASSLRSSR
H
FT                   SGFSHL"
XX
SQ   Sequence 1218 BP; 162 A; 397 C; 387 G; 272 T; 0 other;
     atgagcccct acgggcttaa cctgagccta gtggatgagg caacaacgtg tgtaacaccc        6
0
     agggtcccca atacatctgt ggtgctgcca acaggcggta acggcacatc accagcgctg       12
0
     cctatcttct ccatgacgct gggtgctgtg tccaacgtgc tggcgctggc gctgctggcc       18
0
     caggttgcag gcagactgcg gcgccgccgc tcgactgcca ccttcctgtt gttcgtcgcc       24
0
     agcctgcttg ccatcgacct agcaggccat gtgatcccgg gcgccttggt gcttcgcctg       30
0
     tatactgcag gacgtgcgcc cgctggcggg gcctgtcatt tcctgggcgg ctgtatggtc       36
0
     ttctttggcc tgtgcccact tttgcttggc tgtggcatgg ccgtggagcg ctgcgtgggt       42
0
     gtcacgcagc cgctgatcca cgcggcgcgc gtgtccgtag cccgcgcacg cctggcacta       48
0
     gccctgctgg ccgccatggc tttggcagtg gcgctgctgc cactagtgca cgtgggtcac       54
0
     tacgagctac agtaccctgg cacttggtgt ttcattagcc ttgggcctcc tggaggttgg       60
0
     cgccaggcgt tgcttgcggg cctcttcgcc ggccttggcc tggctgcgct ccttgccgca       66
0
     ctagtgtgta atacgctcag cggcctggcg ctccttcgtg cccgctggag gcggcgtcgc       72
0
     tctcgacgtt tccgagagaa cgcaggtccc gatgatcgcc ggcgctgggg gtcccgtgga       78
0
     ctccgcttgg cctccgcctc gtctgcgtca tccatcactt caaccacagc tgccctccgc       84
0
     agctctcggg gaggcggctc cgcgcgcagg gttcacgcac acgacgtgga aatggtgggc       90
0
     cagctcgtgg gcatcatggt ggtgtcgtgc atctgctgga gccccctgct ggtattggtg       96
0
     gtgttggcca tcgggggctg gaactctaac tccctgcagc ggccgctctt tctggctgta      102
0
     cgcctcgcgt cgtggaacca gatcctggac ccatgggtgt acatcctgct gcgccaggct      108
0
     atgctgcgcc aacttcttcg cctcctaccc ctgagggtta gtgccaaggg tggtccaacg      114
0
     gagctgagcc taaccaagag tgcctgggag gccagttcac tgcgtagctc ccggcacagt      120
0
     ggcttcagcc acttgtga                                                    121
8
//

Output file format

   The output is to both a graphical display and to a text file with the
   default name 'banana.profile'.

   The graphical display shows the sequence together with the local local
   bending (solid line) and macroscopic curvature (dotted line).

  Output files for usage example

  Graphics File: banana.ps

   [banana results]

  Output files for usage example 2

  File: banana.profile

Base   Bend      Curve
a       0.0      0.0
t      19.7      0.0
g      17.7      0.0
a      21.1      0.0
g      28.5      0.0
c      26.2      0.0
c      19.7      0.0
c      18.7      0.0
c      12.5      0.0
t       9.7      0.0
a      14.9      0.0
c      16.5      0.0
g      17.5      0.0
g      26.2      0.0
g      28.5      0.0
c      20.7      0.0
t      11.7      0.0
t       6.4      0.0
a       9.3      0.0
a      14.9      0.0
c      17.7     20.0
c      15.7     19.2
t      15.7     18.5
g      17.7     17.9
a      21.1     17.1
g      28.5     15.9
c      25.2     14.6
c      12.5     13.3
t       7.2     11.9
a      13.2     10.8
g      20.1     10.1
t      19.5      9.6
g      15.1      9.2
g      14.9      9.1
a      19.5      9.5
t      19.7     10.2
g      17.7     10.8
a      17.7     11.0
g      25.2     11.2
g      26.2     11.3
c      15.3     11.5
a      11.4     11.7
a      14.5     12.0
c      13.9     12.2
a      11.4     12.3
a      14.9     12.5
c      17.7     12.8
g      19.5     13.3
t      19.1     13.5


  [Part of this file has been deleted for brevity]

g      15.1     15.2
a      17.7     15.5
g      25.2     15.8
g      32.5     16.0
c      25.2     15.8
c      15.7     15.0
a      16.3     14.2
g      15.5     13.5
t      10.8     12.8
t      13.7     12.3
c      19.5     12.1
a      20.1     12.1
c      16.3     12.1
t      16.7     11.9
g      22.1     11.4
c      21.1     11.1
g      14.9     10.7
t       9.7     10.3
a      16.1      9.8
g      24.5      9.4
c      21.1      8.9
t      15.1      8.4
c      16.1      7.7
c      17.5      7.3
c      15.3      6.9
g      24.0      6.4
g      26.2      5.8
c      20.5      5.4
a      19.1      5.1
c      15.3     26.0
a      16.3      0.0
g      20.1      0.0
t      19.5      0.0
g      25.2      0.0
g      28.5      0.0
c      20.7      0.0
t      13.3      0.0
t      13.7      0.0
c      15.7      0.0
a      19.1      0.0
g      28.5      0.0
c      25.2      0.0
c      19.5      0.0
a      20.1      0.0
c      17.9      0.0
t      13.9      0.0
t      13.9      0.0
g      19.1      0.0
t      19.5      0.0
g       0.0      0.0
a       0.0      0.0

  File: banana1.dat

##Maintitle Bending and curvature plot of tembl-id:U68037
##Subtitle Tue 15 Jul 2008 12:00:00
##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 3.500000 y1 66.743378 x2 4.500000 y2 66.039986 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 4.500000 y1 66.039986 x2 5.500000 y2 67.239151 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 5.500000 y1 67.239151 x2 6.500000 y2 69.829361 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 6.500000 y1 69.829361 x2 7.500000 y2 69.006195 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 7.500000 y1 69.006195 x2 8.500000 y2 66.739983 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 8.500000 y1 66.739983 x2 9.500000 y2 66.390877 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 9.500000 y1 66.390877 x2 10.500000 y2 64.256180 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 10.500000 y1 64.256180 x2 11.500000 y2 63.249973 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 11.500000 y1 63.249973 x2 12.500000 y2 65.068802 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 12.500000 y1 65.068802 x2 13.500000 y2 65.621445 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 13.500000 y1 65.621445 x2 14.500000 y2 65.974617 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0
Text3 x1 15.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 14.500000 y1 65.974617 x2 15.500000 y2 69.006195 colour 0
Line x1 14.500000 y1 59.879997 x2 15.500000 y2 59.879997 colour 0
Text3 x1 16.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 15.500000 y1 69.006195 x2 16.500000 y2 69.829361 colour 0
Line x1 15.500000 y1 59.879997 x2 16.500000 y2 59.879997 colour 0
Text3 x1 17.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 16.500000 y1 69.829361 x2 17.500000 y2 67.101654 colour 0
Line x1 16.500000 y1 59.879997 x2 17.500000 y2 59.879997 colour 0
Text3 x1 18.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 17.500000 y1 67.101654 x2 18.500000 y2 63.978653 colour 0


  [Part of this file has been deleted for brevity]

Line x1 39.500000 y1 30.619976 x2 40.500000 y2 28.755508 colour 0
Line x1 39.700001 y1 23.003500 x2 40.299999 y2 23.142790 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 40.500000 y1 28.755508 x2 41.500000 y2 27.544254 colour 0
Line x1 40.700001 y1 23.142790 x2 41.299999 y2 23.373346 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 41.500000 y1 27.544254 x2 42.500000 y2 28.590876 colour 0
Line x1 41.700001 y1 23.373346 x2 42.299999 y2 23.594351 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 42.500000 y1 28.590876 x2 43.500000 y2 28.590876 colour 0
Line x1 42.700001 y1 23.594351 x2 43.299999 y2 23.768496 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 43.500000 y1 28.590876 x2 44.500000 y2 28.872763 colour 0
Line x1 43.700001 y1 23.768496 x2 44.299999 y2 23.897196 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 44.500000 y1 28.872763 x2 45.500000 y2 29.220503 colour 0
Line x1 44.700001 y1 23.897196 x2 45.299999 y2 23.947048 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 45.500000 y1 29.220503 x2 46.500000 y2 29.784340 colour 0
Line x1 45.700001 y1 23.947048 x2 46.299999 y2 23.960222 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 46.500000 y1 29.784340 x2 47.500000 y2 28.755508 colour 0
Line x1 46.700001 y1 23.960222 x2 47.299999 y2 23.933395 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 47.500000 y1 28.755508 x2 48.500000 y2 27.402790 colour 0
Line x1 47.700001 y1 23.933395 x2 48.299999 y2 23.842730 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 48.500000 y1 27.402790 x2 49.500000 y2 28.734224 colour 0
Line x1 48.700001 y1 23.842730 x2 49.299999 y2 23.635275 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 49.500000 y1 28.734224 x2 50.500000 y2 28.734224 colour 0
Line x1 49.700001 y1 23.635275 x2 50.299999 y2 23.355328 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 50.500000 y1 28.734224 x2 51.500000 y2 28.100136 colour 0
Line x1 50.700001 y1 23.355328 x2 51.299999 y2 23.095020 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 51.500000 y1 28.100136 x2 52.500000 y2 27.337488 colour 0
Line x1 51.700001 y1 23.095020 x2 52.299999 y2 22.881302 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana2.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 2.500000 y1 65.137489 x2 3.500000 y2 65.137489 colour 0
Line x1 2.700000 y1 60.681301 x2 3.300000 y2 60.544445 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 3.500000 y1 65.137489 x2 4.500000 y2 64.863533 colour 0
Line x1 3.700000 y1 60.544445 x2 4.300000 y2 60.511105 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 4.500000 y1 64.863533 x2 5.500000 y2 63.870514 colour 0
Line x1 4.700000 y1 60.511105 x2 5.300000 y2 60.594872 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 5.500000 y1 63.870514 x2 6.500000 y2 65.068802 colour 0
Line x1 5.700000 y1 60.594872 x2 6.300000 y2 60.754246 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 6.500000 y1 65.068802 x2 7.500000 y2 66.039986 colour 0
Line x1 6.700000 y1 60.754246 x2 7.300000 y2 60.980507 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 7.500000 y1 66.039986 x2 8.500000 y2 66.672760 colour 0
Line x1 7.700000 y1 60.980507 x2 8.300000 y2 61.280891 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 8.500000 y1 66.672760 x2 9.500000 y2 67.020500 colour 0
Line x1 8.700000 y1 61.280891 x2 9.300000 y2 61.626850 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 9.500000 y1 67.020500 x2 10.500000 y2 67.584343 colour 0
Line x1 9.700000 y1 61.626850 x2 10.300000 y2 61.980312 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 10.500000 y1 67.584343 x2 11.500000 y2 66.555511 colour 0
Line x1 10.700000 y1 61.980312 x2 11.300000 y2 62.251068 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 11.500000 y1 66.555511 x2 12.500000 y2 65.344254 colour 0
Line x1 11.700000 y1 62.251068 x2 12.300000 y2 62.421207 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 12.500000 y1 65.344254 x2 13.500000 y2 68.666405 colour 0
Line x1 12.700000 y1 62.421207 x2 13.300000 y2 62.520813 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 13.500000 y1 68.666405 x2 14.500000 y2 69.829361 colour 0
Line x1 13.700000 y1 62.520813 x2 14.300000 y2 62.609581 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0


  [Part of this file has been deleted for brevity]

Line x1 39.500000 y1 28.239983 x2 40.500000 y2 28.872763 colour 0
Line x1 39.700001 y1 25.297361 x2 40.299999 y2 25.211924 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 40.500000 y1 28.872763 x2 41.500000 y2 29.220503 colour 0
Line x1 40.700001 y1 25.211924 x2 41.299999 y2 25.157118 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 41.500000 y1 29.220503 x2 42.500000 y2 29.784340 colour 0
Line x1 41.700001 y1 25.157118 x2 42.299999 y2 25.166603 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 42.500000 y1 29.784340 x2 43.500000 y2 29.301651 colour 0
Line x1 42.700001 y1 25.166603 x2 43.299999 y2 25.246220 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 43.500000 y1 29.301651 x2 44.500000 y2 26.716318 colour 0
Line x1 43.700001 y1 25.246220 x2 44.299999 y2 25.346378 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 44.500000 y1 26.716318 x2 45.500000 y2 28.517347 colour 0
Line x1 44.700001 y1 25.346378 x2 45.299999 y2 25.396358 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 45.500000 y1 28.517347 x2 46.500000 y2 31.040913 colour 0
Line x1 45.700001 y1 25.396358 x2 46.299999 y2 25.410254 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 46.500000 y1 31.040913 x2 47.500000 y2 32.029358 colour 0
Line x1 46.700001 y1 25.410254 x2 47.299999 y2 25.458986 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 47.500000 y1 32.029358 x2 48.500000 y2 30.866404 colour 0
Line x1 47.700001 y1 25.458986 x2 48.299999 y2 25.576269 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 48.500000 y1 30.866404 x2 49.500000 y2 27.544254 colour 0
Line x1 48.700001 y1 25.576269 x2 49.299999 y2 25.788673 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 49.500000 y1 27.544254 x2 50.500000 y2 27.402790 colour 0
Line x1 49.700001 y1 25.788673 x2 50.299999 y2 26.104589 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 50.500000 y1 27.402790 x2 51.500000 y2 27.126646 colour 0
Line x1 50.700001 y1 26.104589 x2 51.299999 y2 26.532801 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 51.500000 y1 27.126646 x2 52.500000 y2 25.793066 colour 0
Line x1 51.700001 y1 26.532801 x2 52.299999 y2 26.954660 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana3.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 2.500000 y1 63.593067 x2 3.500000 y2 63.099991 colour 0
Line x1 2.700000 y1 64.754662 x2 3.300000 y2 65.133415 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 3.500000 y1 63.099991 x2 4.500000 y2 63.593067 colour 0
Line x1 3.700000 y1 65.133415 x2 4.300000 y2 65.494942 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 4.500000 y1 63.593067 x2 5.500000 y2 65.282478 colour 0
Line x1 4.700000 y1 65.494942 x2 5.300000 y2 65.884865 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 5.500000 y1 65.282478 x2 6.500000 y2 65.556931 colour 0
Line x1 5.700000 y1 65.884865 x2 6.300000 y2 66.289825 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 6.500000 y1 65.556931 x2 7.500000 y2 65.699013 colour 0
Line x1 6.700000 y1 66.289825 x2 7.300000 y2 66.623062 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 7.500000 y1 65.699013 x2 8.500000 y2 66.739983 colour 0
Line x1 7.700000 y1 66.623062 x2 8.300000 y2 66.775955 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 8.500000 y1 66.739983 x2 9.500000 y2 65.699013 colour 0
Line x1 8.700000 y1 66.775955 x2 9.300000 y2 66.715889 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 9.500000 y1 65.699013 x2 10.500000 y2 65.344254 colour 0
Line x1 9.700000 y1 66.715889 x2 10.300000 y2 66.529877 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 10.500000 y1 65.344254 x2 11.500000 y2 65.137489 colour 0
Line x1 10.700000 y1 66.529877 x2 11.300000 y2 66.281395 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 11.500000 y1 65.137489 x2 12.500000 y2 65.137489 colour 0
Line x1 11.700000 y1 66.281395 x2 12.300000 y2 65.988609 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 12.500000 y1 65.137489 x2 13.500000 y2 66.039986 colour 0
Line x1 12.700000 y1 65.988609 x2 13.300000 y2 65.580658 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 13.500000 y1 66.039986 x2 14.500000 y2 66.039986 colour 0
Line x1 13.700000 y1 65.580658 x2 14.300000 y2 65.121658 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0


  [Part of this file has been deleted for brevity]

Line x1 39.500000 y1 27.337502 x2 40.500000 y2 28.872780 colour 0
Line x1 39.700001 y1 23.195293 x2 40.299999 y2 23.514277 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 40.500000 y1 28.872780 x2 41.500000 y2 28.872780 colour 0
Line x1 40.700001 y1 23.514277 x2 41.299999 y2 23.725180 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 41.500000 y1 28.872780 x2 42.500000 y2 29.439165 colour 0
Line x1 41.700001 y1 23.725180 x2 42.299999 y2 23.913559 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 42.500000 y1 29.439165 x2 43.500000 y2 30.619995 colour 0
Line x1 42.700001 y1 23.913559 x2 43.299999 y2 24.094633 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 43.500000 y1 30.619995 x2 44.500000 y2 29.027782 colour 0
Line x1 43.700001 y1 24.094633 x2 44.299999 y2 24.189123 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 44.500000 y1 29.027782 x2 45.500000 y2 30.461622 colour 0
Line x1 44.700001 y1 24.189123 x2 45.299999 y2 24.257391 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 45.500000 y1 30.461622 x2 46.500000 y2 32.029381 colour 0
Line x1 45.700001 y1 24.257391 x2 46.299999 y2 24.323919 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 46.500000 y1 32.029381 x2 47.500000 y2 30.619997 colour 0
Line x1 46.700001 y1 24.323919 x2 47.299999 y2 24.341711 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 47.500000 y1 30.619997 x2 48.500000 y2 30.619995 colour 0
Line x1 47.700001 y1 24.341711 x2 48.299999 y2 24.317751 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 48.500000 y1 30.619995 x2 49.500000 y2 30.619995 colour 0
Line x1 48.700001 y1 24.317751 x2 49.299999 y2 24.263824 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 49.500000 y1 30.619995 x2 50.500000 y2 30.619995 colour 0
Line x1 49.700001 y1 24.263824 x2 50.299999 y2 24.170179 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 50.500000 y1 30.619995 x2 51.500000 y2 29.439163 colour 0
Line x1 50.700001 y1 24.170179 x2 51.299999 y2 24.108042 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 51.500000 y1 29.439163 x2 52.500000 y2 28.872782 colour 0
Line x1 51.700001 y1 24.108042 x2 52.299999 y2 24.028461 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana4.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 2.500000 y1 66.672783 x2 3.500000 y2 66.534241 colour 0
Line x1 2.700000 y1 61.828465 x2 3.300000 y2 61.655918 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 3.500000 y1 66.534241 x2 4.500000 y2 65.900154 colour 0
Line x1 3.700000 y1 61.655918 x2 4.300000 y2 61.406971 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 4.500000 y1 65.900154 x2 5.500000 y2 65.137497 colour 0
Line x1 4.700000 y1 61.406971 x2 5.300000 y2 61.120125 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 5.500000 y1 65.137497 x2 6.500000 y2 64.712364 colour 0
Line x1 5.700000 y1 61.120125 x2 6.300000 y2 60.966141 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 6.500000 y1 64.712364 x2 7.500000 y2 65.621460 colour 0
Line x1 6.700000 y1 60.966141 x2 7.300000 y2 61.082630 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 7.500000 y1 65.621460 x2 8.500000 y2 65.068817 colour 0
Line x1 7.700000 y1 61.082630 x2 8.300000 y2 61.373486 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 8.500000 y1 65.068817 x2 9.500000 y2 63.249981 colour 0
Line x1 8.700000 y1 61.373486 x2 9.300000 y2 61.680435 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 9.500000 y1 63.249981 x2 10.500000 y2 65.487465 colour 0
Line x1 9.700000 y1 61.680435 x2 10.300000 y2 61.938324 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 10.500000 y1 65.487465 x2 11.500000 y2 69.829384 colour 0
Line x1 10.700000 y1 61.938324 x2 11.300000 y2 62.114063 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 11.500000 y1 69.829384 x2 12.500000 y2 69.006210 colour 0
Line x1 11.700000 y1 62.114063 x2 12.300000 y2 62.217667 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 12.500000 y1 69.006210 x2 13.500000 y2 65.974632 colour 0
Line x1 12.700000 y1 62.217667 x2 13.300000 y2 62.395542 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 13.500000 y1 65.974632 x2 14.500000 y2 66.827782 colour 0
Line x1 13.700000 y1 62.395542 x2 14.300000 y2 62.722473 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0


  [Part of this file has been deleted for brevity]

Line x1 39.500000 y1 27.337500 x2 40.500000 y2 27.337502 colour 0
Line x1 39.700001 y1 23.704889 x2 40.299999 y2 23.752373 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 40.500000 y1 27.337502 x2 41.500000 y2 27.544268 colour 0
Line x1 40.700001 y1 23.752373 x2 41.299999 y2 23.564180 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 41.500000 y1 27.544268 x2 42.500000 y2 27.544266 colour 0
Line x1 41.700001 y1 23.564180 x2 42.299999 y2 23.118820 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 42.500000 y1 27.544266 x2 43.500000 y2 27.337500 colour 0
Line x1 42.700001 y1 23.118820 x2 43.299999 y2 22.534410 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 43.500000 y1 27.337500 x2 44.500000 y2 27.337500 colour 0
Line x1 43.700001 y1 22.534410 x2 44.299999 y2 22.310280 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 44.500000 y1 27.337500 x2 45.500000 y2 28.239996 colour 0
Line x1 44.700001 y1 22.310280 x2 45.299999 y2 22.911076 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 45.500000 y1 28.239996 x2 46.500000 y2 28.239998 colour 0
Line x1 45.700001 y1 22.911076 x2 46.299999 y2 23.363279 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 46.500000 y1 28.239998 x2 47.500000 y2 27.268816 colour 0
Line x1 46.700001 y1 23.363279 x2 47.299999 y2 23.501678 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 47.500000 y1 27.268816 x2 48.500000 y2 26.070522 colour 0
Line x1 47.700001 y1 23.501678 x2 48.299999 y2 23.429628 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 48.500000 y1 26.070522 x2 49.500000 y2 27.063545 colour 0
Line x1 48.700001 y1 23.429628 x2 49.299999 y2 23.272099 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 49.500000 y1 27.063545 x2 50.500000 y2 30.866423 colour 0
Line x1 49.700001 y1 23.272099 x2 50.299999 y2 23.060772 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 50.500000 y1 30.866423 x2 51.500000 y2 32.029377 colour 0
Line x1 50.700001 y1 23.060772 x2 51.299999 y2 22.790617 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 51.500000 y1 32.029377 x2 52.500000 y2 30.619995 colour 0
Line x1 51.700001 y1 22.790617 x2 52.299999 y2 22.560194 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana5.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 2.500000 y1 68.419998 x2 3.500000 y2 69.829384 colour 0
Line x1 2.700000 y1 60.360195 x2 3.300000 y2 60.585083 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 3.500000 y1 69.829384 x2 4.500000 y2 68.666428 colour 0
Line x1 3.700000 y1 60.585083 x2 4.300000 y2 61.013470 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 4.500000 y1 68.666428 x2 5.500000 y2 65.344269 colour 0
Line x1 4.700000 y1 61.013470 x2 5.300000 y2 61.481304 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 5.500000 y1 65.344269 x2 6.500000 y2 65.344269 colour 0
Line x1 5.700000 y1 61.481304 x2 6.300000 y2 61.902313 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 6.500000 y1 65.344269 x2 7.500000 y2 68.666420 colour 0
Line x1 6.700000 y1 61.902313 x2 7.300000 y2 62.285793 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 7.500000 y1 68.666420 x2 8.500000 y2 69.829384 colour 0
Line x1 7.700000 y1 62.285793 x2 8.300000 y2 62.709625 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 8.500000 y1 69.829384 x2 9.500000 y2 67.239166 colour 0
Line x1 8.700000 y1 62.709625 x2 9.300000 y2 63.136959 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 9.500000 y1 67.239166 x2 10.500000 y2 65.068817 colour 0
Line x1 9.700000 y1 63.136959 x2 10.300000 y2 63.549583 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 10.500000 y1 65.068817 x2 11.500000 y2 63.870525 colour 0
Line x1 10.700000 y1 63.549583 x2 11.300000 y2 63.774982 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 11.500000 y1 63.870525 x2 12.500000 y2 65.221176 colour 0
Line x1 11.700000 y1 63.774982 x2 12.300000 y2 63.695026 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 12.500000 y1 65.221176 x2 13.500000 y2 67.584358 colour 0
Line x1 12.700000 y1 63.695026 x2 13.300000 y2 63.577515 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 13.500000 y1 67.584358 x2 14.500000 y2 67.101669 colour 0
Line x1 13.700000 y1 63.577515 x2 14.300000 y2 63.684265 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0


  [Part of this file has been deleted for brevity]

Line x1 39.500000 y1 25.650585 x2 40.500000 y2 25.862221 colour 0
Line x1 39.700001 y1 26.883871 x2 40.299999 y2 26.705711 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 40.500000 y1 25.862221 x2 41.500000 y2 27.268818 colour 0
Line x1 40.700001 y1 26.705711 x2 41.299999 y2 26.361605 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 41.500000 y1 27.268818 x2 42.500000 y2 29.439165 colour 0
Line x1 41.700001 y1 26.361605 x2 42.299999 y2 25.989439 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 42.500000 y1 29.439165 x2 43.500000 y2 29.784359 colour 0
Line x1 42.700001 y1 25.989439 x2 43.299999 y2 25.613720 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 43.500000 y1 29.784359 x2 44.500000 y2 27.899025 colour 0
Line x1 43.700001 y1 25.613720 x2 44.299999 y2 25.178097 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 44.500000 y1 27.899025 x2 45.500000 y2 27.544268 colour 0
Line x1 44.700001 y1 25.178097 x2 45.299999 y2 24.749298 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 45.500000 y1 27.544268 x2 46.500000 y2 28.239996 colour 0
Line x1 45.700001 y1 24.749298 x2 46.299999 y2 24.392622 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 46.500000 y1 28.239996 x2 47.500000 y2 28.239998 colour 0
Line x1 46.700001 y1 24.392622 x2 47.299999 y2 24.093618 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 47.500000 y1 28.239998 x2 48.500000 y2 27.337502 colour 0
Line x1 47.700001 y1 24.093618 x2 48.299999 y2 23.838957 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 48.500000 y1 27.337502 x2 49.500000 y2 27.693478 colour 0
Line x1 48.700001 y1 23.838957 x2 49.299999 y2 23.746647 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 49.500000 y1 27.693478 x2 50.500000 y2 28.174627 colour 0
Line x1 49.700001 y1 23.746647 x2 50.299999 y2 23.926149 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 50.500000 y1 28.174627 x2 51.500000 y2 29.456642 colour 0
Line x1 50.700001 y1 23.926149 x2 51.299999 y2 24.253155 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 51.500000 y1 29.456642 x2 52.500000 y2 29.797428 colour 0
Line x1 51.700001 y1 24.253155 x2 52.299999 y2 24.528038 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana6.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 2.500000 y1 67.597427 x2 3.500000 y2 66.674156 colour 0
Line x1 2.700000 y1 62.328037 x2 3.300000 y2 62.416805 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 3.500000 y1 66.674156 x2 4.500000 y2 66.743401 colour 0
Line x1 3.700000 y1 62.416805 x2 4.300000 y2 62.254288 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 4.500000 y1 66.743401 x2 5.500000 y2 65.970032 colour 0
Line x1 4.700000 y1 62.254288 x2 5.300000 y2 61.970638 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 5.500000 y1 65.970032 x2 6.500000 y2 65.899994 colour 0
Line x1 5.700000 y1 61.970638 x2 6.300000 y2 61.661148 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 6.500000 y1 65.899994 x2 7.500000 y2 67.597435 colour 0
Line x1 6.700000 y1 61.661148 x2 7.300000 y2 61.432491 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 7.500000 y1 67.597435 x2 8.500000 y2 68.840935 colour 0
Line x1 7.700000 y1 61.432491 x2 8.300000 y2 61.330070 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 8.500000 y1 68.840935 x2 9.500000 y2 69.829384 colour 0
Line x1 8.700000 y1 61.330070 x2 9.300000 y2 61.328545 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 9.500000 y1 69.829384 x2 10.500000 y2 68.261620 colour 0
Line x1 9.700000 y1 61.328545 x2 10.300000 y2 61.365147 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 10.500000 y1 68.261620 x2 11.500000 y2 65.199997 colour 0
Line x1 10.700000 y1 61.365147 x2 11.300000 y2 61.341957 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 11.500000 y1 65.199997 x2 12.500000 y2 68.261627 colour 0
Line x1 11.700000 y1 61.341957 x2 12.300000 y2 61.208694 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 12.500000 y1 68.261627 x2 13.500000 y2 69.829384 colour 0
Line x1 12.700000 y1 61.208694 x2 13.300000 y2 61.004723 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 13.500000 y1 69.829384 x2 14.500000 y2 68.419998 colour 0
Line x1 13.700000 y1 61.004723 x2 14.300000 y2 60.776642 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0


  [Part of this file has been deleted for brevity]

Line x1 39.500000 y1 27.337502 x2 40.500000 y2 25.932964 colour 0
Line x1 39.700001 y1 26.760599 x2 40.299999 y2 26.561565 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 40.500000 y1 25.932964 x2 41.500000 y2 23.838167 colour 0
Line x1 40.700001 y1 26.561565 x2 41.299999 y2 26.351305 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 41.500000 y1 23.838167 x2 42.500000 y2 22.519539 colour 0
Line x1 41.700001 y1 26.351305 x2 42.299999 y2 26.186651 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 42.500000 y1 22.519539 x2 43.500000 y2 26.406086 colour 0
Line x1 42.700001 y1 26.186651 x2 43.299999 y2 26.055754 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 43.500000 y1 26.406086 x2 44.500000 y2 28.943396 colour 0
Line x1 43.700001 y1 26.055754 x2 44.299999 y2 25.993534 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 44.500000 y1 28.943396 x2 45.500000 y2 28.239996 colour 0
Line x1 44.700001 y1 25.993534 x2 45.299999 y2 25.990919 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 45.500000 y1 28.239996 x2 46.500000 y2 28.872778 colour 0
Line x1 45.700001 y1 25.990919 x2 46.299999 y2 26.011547 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 46.500000 y1 28.872778 x2 47.500000 y2 28.872778 colour 0
Line x1 46.700001 y1 26.011547 x2 47.299999 y2 25.996107 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 47.500000 y1 28.872778 x2 48.500000 y2 28.590893 colour 0
Line x1 47.700001 y1 25.996107 x2 48.299999 y2 25.948639 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 48.500000 y1 28.590893 x2 49.500000 y2 31.206213 colour 0
Line x1 48.700001 y1 25.948639 x2 49.299999 y2 25.882645 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 49.500000 y1 31.206213 x2 50.500000 y2 33.419998 colour 0
Line x1 49.700001 y1 25.882645 x2 50.299999 y2 25.782410 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 50.500000 y1 33.419998 x2 51.500000 y2 30.866423 colour 0
Line x1 50.700001 y1 25.782410 x2 51.299999 y2 25.683741 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 51.500000 y1 30.866423 x2 52.500000 y2 27.544268 colour 0
Line x1 51.700001 y1 25.683741 x2 52.299999 y2 25.548004 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana7.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 2.500000 y1 65.344269 x2 3.500000 y2 66.555527 colour 0
Line x1 2.700000 y1 63.348003 x2 3.300000 y2 63.123909 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 3.500000 y1 66.555527 x2 4.500000 y2 68.419998 colour 0
Line x1 3.700000 y1 63.123909 x2 4.300000 y2 62.875870 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 4.500000 y1 68.419998 x2 5.500000 y2 67.239166 colour 0
Line x1 4.700000 y1 62.875870 x2 5.300000 y2 62.678192 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 5.500000 y1 67.239166 x2 6.500000 y2 67.665863 colour 0
Line x1 5.700000 y1 62.678192 x2 6.300000 y2 62.539165 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 6.500000 y1 67.665863 x2 7.500000 y2 67.665863 colour 0
Line x1 6.700000 y1 62.539165 x2 7.300000 y2 62.422813 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 7.500000 y1 67.665863 x2 8.500000 y2 66.672783 colour 0
Line x1 7.700000 y1 62.422813 x2 8.300000 y2 62.339989 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 8.500000 y1 66.672783 x2 9.500000 y2 66.672775 colour 0
Line x1 8.700000 y1 62.339989 x2 9.300000 y2 62.321423 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 9.500000 y1 66.672775 x2 10.500000 y2 66.390892 colour 0
Line x1 9.700000 y1 62.321423 x2 10.300000 y2 62.246059 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 10.500000 y1 66.390892 x2 11.500000 y2 69.006210 colour 0
Line x1 10.700000 y1 62.246059 x2 11.300000 y2 61.992630 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 11.500000 y1 69.006210 x2 12.500000 y2 69.006210 colour 0
Line x1 11.700000 y1 61.992630 x2 12.300000 y2 61.625458 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 12.500000 y1 69.006210 x2 13.500000 y2 67.090805 colour 0
Line x1 12.700000 y1 61.625458 x2 13.300000 y2 61.247803 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 13.500000 y1 67.090805 x2 14.500000 y2 66.674156 colour 0
Line x1 13.700000 y1 61.247803 x2 14.300000 y2 60.848763 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0


  [Part of this file has been deleted for brevity]

Line x1 39.500000 y1 28.239998 x2 40.500000 y2 27.544270 colour 0
Line x1 39.700001 y1 23.841955 x2 40.299999 y2 24.126343 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 40.500000 y1 27.544270 x2 41.500000 y2 26.352673 colour 0
Line x1 40.700001 y1 24.126343 x2 41.299999 y2 24.351053 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 41.500000 y1 26.352673 x2 42.500000 y2 26.992170 colour 0
Line x1 41.700001 y1 24.351053 x2 42.299999 y2 24.436802 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 42.500000 y1 26.992170 x2 43.500000 y2 28.099997 colour 0
Line x1 42.700001 y1 24.436802 x2 43.299999 y2 24.436804 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 43.500000 y1 28.099997 x2 44.500000 y2 27.266478 colour 0
Line x1 43.700001 y1 24.436804 x2 44.299999 y2 24.455681 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 44.500000 y1 27.266478 x2 45.500000 y2 27.337502 colour 0
Line x1 44.700001 y1 24.455681 x2 45.299999 y2 24.478355 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 45.500000 y1 27.337502 x2 46.500000 y2 27.544266 colour 0
Line x1 45.700001 y1 24.478355 x2 46.299999 y2 24.473019 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 46.500000 y1 27.544266 x2 47.500000 y2 27.544268 colour 0
Line x1 46.700001 y1 24.473019 x2 47.299999 y2 24.396660 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 47.500000 y1 27.544268 x2 48.500000 y2 27.337502 colour 0
Line x1 47.700001 y1 24.396660 x2 48.299999 y2 24.241009 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 48.500000 y1 27.337502 x2 49.500000 y2 27.337500 colour 0
Line x1 48.700001 y1 24.241009 x2 49.299999 y2 24.069206 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 49.500000 y1 27.337500 x2 50.500000 y2 28.239998 colour 0
Line x1 49.700001 y1 24.069206 x2 50.299999 y2 23.893618 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 50.500000 y1 28.239998 x2 51.500000 y2 28.590893 colour 0
Line x1 50.700001 y1 23.893618 x2 51.299999 y2 23.721313 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 51.500000 y1 28.590893 x2 52.500000 y2 28.590891 colour 0
Line x1 51.700001 y1 23.721313 x2 52.299999 y2 23.592621 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana8.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 2.500000 y1 66.390892 x2 3.500000 y2 66.743401 colour 0
Line x1 2.700000 y1 61.392624 x2 3.300000 y2 61.275394 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 3.500000 y1 66.743401 x2 4.500000 y2 67.439995 colour 0
Line x1 3.700000 y1 61.275394 x2 4.300000 y2 61.149536 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 4.500000 y1 67.439995 x2 5.500000 y2 66.743401 colour 0
Line x1 4.700000 y1 61.149536 x2 5.300000 y2 61.106289 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 5.500000 y1 66.743401 x2 6.500000 y2 66.390892 colour 0
Line x1 5.700000 y1 61.106289 x2 6.300000 y2 61.153751 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 6.500000 y1 66.390892 x2 7.500000 y2 66.390892 colour 0
Line x1 6.700000 y1 61.153751 x2 7.300000 y2 61.233421 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 7.500000 y1 66.390892 x2 8.500000 y2 66.672783 colour 0
Line x1 7.700000 y1 61.233421 x2 8.300000 y2 61.397869 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 8.500000 y1 66.672783 x2 9.500000 y2 66.534241 colour 0
Line x1 8.700000 y1 61.397869 x2 9.300000 y2 61.571949 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 9.500000 y1 66.534241 x2 10.500000 y2 64.926659 colour 0
Line x1 9.700000 y1 61.571949 x2 10.300000 y2 61.715958 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 10.500000 y1 64.926659 x2 11.500000 y2 64.079994 colour 0
Line x1 10.700000 y1 61.715958 x2 11.300000 y2 61.911018 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 11.500000 y1 64.079994 x2 12.500000 y2 64.926659 colour 0
Line x1 11.700000 y1 61.911018 x2 12.300000 y2 62.111980 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 12.500000 y1 64.926659 x2 13.500000 y2 66.604996 colour 0
Line x1 12.700000 y1 62.111980 x2 13.300000 y2 62.277493 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 13.500000 y1 66.604996 x2 14.500000 y2 66.674156 colour 0
Line x1 13.700000 y1 62.277493 x2 14.300000 y2 62.375381 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0


  [Part of this file has been deleted for brevity]

Text3 x1 39.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 38.500000 y1 30.619995 x2 39.500000 y2 29.439165 colour 0
Line x1 38.700001 y1 26.183287 x2 39.299999 y2 25.984793 colour 0
Line x1 38.500000 y1 22.079996 x2 39.500000 y2 22.079996 colour 0
Text3 x1 40.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 39.500000 y1 29.439165 x2 40.500000 y2 27.337502 colour 0
Line x1 39.700001 y1 25.984793 x2 40.299999 y2 25.732311 colour 0
Line x1 39.500000 y1 22.079996 x2 40.500000 y2 22.079996 colour 0
Text3 x1 41.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 40.500000 y1 27.337502 x2 41.500000 y2 27.693478 colour 0
Line x1 40.700001 y1 25.732311 x2 41.299999 y2 25.440313 colour 0
Line x1 40.500000 y1 22.079996 x2 41.500000 y2 22.079996 colour 0
Text3 x1 42.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 41.500000 y1 27.693478 x2 42.500000 y2 28.174629 colour 0
Line x1 41.700001 y1 25.440313 x2 42.299999 y2 25.244444 colour 0
Line x1 41.500000 y1 22.079996 x2 42.500000 y2 22.079996 colour 0
Text3 x1 43.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 42.500000 y1 28.174629 x2 43.500000 y2 27.399996 colour 0
Line x1 42.700001 y1 25.244444 x2 43.299999 y2 25.109406 colour 0
Line x1 42.500000 y1 22.079996 x2 43.500000 y2 22.079996 colour 0
Text3 x1 44.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 43.500000 y1 27.399996 x2 44.500000 y2 30.461622 colour 0
Line x1 43.700001 y1 25.109406 x2 44.299999 y2 24.874926 colour 0
Line x1 43.500000 y1 22.079996 x2 44.500000 y2 22.079996 colour 0
Text3 x1 45.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 44.500000 y1 30.461622 x2 45.500000 y2 31.206211 colour 0
Line x1 44.700001 y1 24.874926 x2 45.299999 y2 24.621588 colour 0
Line x1 44.500000 y1 22.079996 x2 45.500000 y2 22.079996 colour 0
Text3 x1 46.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 45.500000 y1 31.206211 x2 46.500000 y2 29.220520 colour 0
Line x1 45.700001 y1 24.621588 x2 46.299999 y2 24.433867 colour 0
Line x1 45.500000 y1 22.079996 x2 46.500000 y2 22.079996 colour 0
Text3 x1 47.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 46.500000 y1 29.220520 x2 47.500000 y2 28.734240 colour 0
Line x1 46.700001 y1 24.433867 x2 47.299999 y2 24.306047 colour 0
Line x1 46.500000 y1 22.079996 x2 47.500000 y2 22.079996 colour 0
Text3 x1 48.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 47.500000 y1 28.734240 x2 48.500000 y2 27.402800 colour 0
Line x1 47.500000 y1 22.079996 x2 48.500000 y2 22.079996 colour 0
Text3 x1 49.000000 y1 18.299995 colour 0 size 9.600000 c
Line x1 48.500000 y1 27.402800 x2 49.500000 y2 27.756945 colour 0
Line x1 48.500000 y1 22.079996 x2 49.500000 y2 22.079996 colour 0
Text3 x1 50.000000 y1 18.299995 colour 0 size 9.600000 a
Line x1 49.500000 y1 27.756945 x2 50.500000 y2 29.081196 colour 0
Line x1 49.500000 y1 22.079996 x2 50.500000 y2 22.079996 colour 0
Text3 x1 51.000000 y1 18.299995 colour 0 size 9.600000 g
Line x1 50.500000 y1 29.081196 x2 51.500000 y2 28.872778 colour 0
Line x1 50.500000 y1 22.079996 x2 51.500000 y2 22.079996 colour 0
Text3 x1 52.000000 y1 18.299995 colour 0 size 9.600000 t
Line x1 51.500000 y1 28.872778 x2 52.500000 y2 30.866423 colour 0
Line x1 51.500000 y1 22.079996 x2 52.500000 y2 22.079996 colour 0

  File: banana9.dat

##Graphic
##Screen x1 -1.000000 y1 0.000000 x2 60.000000 y2 80.000000
Text3 x1 3.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 2.500000 y1 68.666420 x2 3.500000 y2 69.829384 colour 0
Line x1 2.500000 y1 59.879997 x2 3.500000 y2 59.879997 colour 0
Text3 x1 4.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 3.500000 y1 69.829384 x2 4.500000 y2 67.101669 colour 0
Line x1 3.500000 y1 59.879997 x2 4.500000 y2 59.879997 colour 0
Text3 x1 5.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 4.500000 y1 67.101669 x2 5.500000 y2 64.516327 colour 0
Line x1 4.500000 y1 59.879997 x2 5.500000 y2 59.879997 colour 0
Text3 x1 6.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 5.500000 y1 64.516327 x2 6.500000 y2 64.659561 colour 0
Line x1 5.500000 y1 59.879997 x2 6.500000 y2 59.879997 colour 0
Text3 x1 7.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 6.500000 y1 64.659561 x2 7.500000 y2 65.344269 colour 0
Line x1 6.500000 y1 59.879997 x2 7.500000 y2 59.879997 colour 0
Text3 x1 8.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 7.500000 y1 65.344269 x2 8.500000 y2 66.555527 colour 0
Line x1 7.500000 y1 59.879997 x2 8.500000 y2 59.879997 colour 0
Text3 x1 9.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 8.500000 y1 66.555527 x2 9.500000 y2 69.829384 colour 0
Line x1 8.500000 y1 59.879997 x2 9.500000 y2 59.879997 colour 0
Text3 x1 10.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 9.500000 y1 69.829384 x2 10.500000 y2 68.666420 colour 0
Line x1 9.500000 y1 59.879997 x2 10.500000 y2 59.879997 colour 0
Text3 x1 11.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 10.500000 y1 68.666420 x2 11.500000 y2 66.672783 colour 0
Line x1 10.500000 y1 59.879997 x2 11.500000 y2 59.879997 colour 0
Text3 x1 12.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 11.500000 y1 66.672783 x2 12.500000 y2 66.881195 colour 0
Line x1 11.500000 y1 59.879997 x2 12.500000 y2 59.879997 colour 0
Text3 x1 13.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 12.500000 y1 66.881195 x2 13.500000 y2 66.110931 colour 0
Line x1 12.500000 y1 59.879997 x2 13.500000 y2 59.879997 colour 0
Text3 x1 14.000000 y1 56.099998 colour 0 size 9.600000 c
Line x1 13.500000 y1 66.110931 x2 14.500000 y2 64.720856 colour 0
Line x1 13.500000 y1 59.879997 x2 14.500000 y2 59.879997 colour 0
Text3 x1 15.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 14.500000 y1 64.720856 x2 15.500000 y2 64.720856 colour 0
Line x1 14.500000 y1 59.879997 x2 15.500000 y2 59.879997 colour 0
Text3 x1 16.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 15.500000 y1 64.720856 x2 16.500000 y2 66.534241 colour 0
Line x1 15.500000 y1 59.879997 x2 16.500000 y2 59.879997 colour 0
Text3 x1 17.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 16.500000 y1 66.534241 x2 17.500000 y2 66.672783 colour 0
Line x1 16.500000 y1 59.879997 x2 17.500000 y2 59.879997 colour 0
Text3 x1 18.000000 y1 56.099998 colour 0 size 9.600000 t
Line x1 17.500000 y1 66.672783 x2 18.500000 y2 59.879997 colour 0
Line x1 17.500000 y1 59.879997 x2 18.500000 y2 59.879997 colour 0
Text3 x1 19.000000 y1 56.099998 colour 0 size 9.600000 g
Line x1 18.500000 y1 59.879997 x2 19.500000 y2 59.879997 colour 0
Line x1 18.500000 y1 59.879997 x2 19.500000 y2 59.879997 colour 0
Text3 x1 20.000000 y1 56.099998 colour 0 size 9.600000 a
Line x1 19.500000 y1 59.879997 x2 20.500000 y2 59.879997 colour 0

   The data file consists of three columns separated by blanks or tab
   characters.

   The first column is the sequence.
   The second column is the local bending.
   The third is the curvature.

Data files

   banana requires a data file in the EMBOSS data directory containing
   the twist, roll and tilt angles. By default Eangles_tri.dat is used,
   as in Goodsell & Dickerson, NAR 1994 11;22(24):5497-503 and Drew and
   Travers (1986) JMB 191, 659. Some other file may be specified with the
   -anglesfile option.

   The description of this bending model is as follows:

   The roll-tilt-twist parameters of this model are derived purely from
   experimental observations of sequence location preferences of base
   trimers in small circles of DNA, without reference to solution
   techniques that measure curvature per se. For this reason, they may be
   the most objective and unbiased parameters of all. Satchwell, Drew and
   Travers studied the positioning of DNA sequences wrappped around
   nucleosome cores, and in closed circles of double-helical DNA of
   comparable size. From the sequence data they calculated a fractional
   preference of each base pair triplet for a position 'facing out', or
   with the major groove on the concave side of the curved helix. The
   sequence GGC, for example, has a 45% preference for locations on a
   bent double helix in which its major groove faces inward and is
   compressed by the curvature (tending towards positive roll), whereas
   sequence AAA has a 36% preference for the opposite orientation, with
   major groove facing outward and with minor groove facing inward and
   compressed (tending toward negative roll). These fractional variances
   have been converted into roll angles in the following manner: Because
   x-ray cyrstal structure analysis uniformly indicates that AA steps are
   unbent, a zero roll is assigned to the AAA triplet; an arbitrary
   maximum roll of 10 degrees is asigned to GGC, and all other triplets
   are scaled in a lenear manner. Where % is the percent-out figure,
   then:

         Roll = 10 degrees * (% + 36)/(45 + 36)

   Changing the maximum roll value will scale the entire profile up or
   down proportionately, but will not change the shape of the profile.
   Peaks will remain peaks, and valleys, valleys. The absolute magnitide
   of all the roll values is less important than their relative
   magnitude, or the order of roll preference. Twist angles were set to
   zero. Because these values correspond to base trimers, the values of
   roll, tilt and twist were applied to the first two bases for the
   calculation.

Notes

   DNA bending is vital for the winding of DNA in nucleosomes, and the
   recognition of particular DNA loci by restriction enzymes, repressors
   and other control proteins. For example, the binding of the catabolite
   gene activator protein and of the TATA-box recognition protein to a
   double DNA helix both rely on major bends in the helix induced at
   specific sequence loci. Whether the particular recognition sequences
   are bent even in the absence of proteins is not always clear: a
   preformed bend in the DNA would form a custom site for protein
   binding, or an enhanced bendability of a given sequence would
   facilitate protein-induced bending. Sadly, the rules of
   sequence-dependent DNA bending remain elusive.

   Two models of sequence-dependent bending in free DNA have been
   proposed. Nearest neighbor models propose that large-scale measurable
   curvature may arise by the accumulation of many small local
   deformations in helical twist, roll, tilt and slide at individual
   steps between base pairs. In contrast, junction models propose that
   bending occurs at the interface between two different structural
   variants of the B-DNA double helix.

   In both models, sequences which are anisotropically bendable - for
   instance, sequences with steps that preferentially bend only to
   compress the major groove - will lead to an average structure which is
   similar to a sequence with a rigid, intrinsic bend. The default
   bending model (see below) used by banana does not distinguish between
   these two possibilities.

   B-DNA has the special property of having its base pairs very nearly
   perpendicular to the overall helix axis. Hence the normal vector to
   each base pair can be taken as representing the local helix at that
   point, and curvature and bending can be studied simply by observing
   the behaviour of the normal vectors from one base to another along the
   helix. This is both easy to calculate and simple to interpret. This
   program display the magnitude of bending and curvature at each point
   along the sequence. It is not intended as a substitute for more
   elaborate three-dimensional trajectory calculations, but only to
   express bending tendencies as a function of sequence. This affords
   easy screening for regions of a given DNA sequence where phased local
   bends add constructively to form an overall curve.

   The terms bending and curvature are used in a restricted sense here.
   Bending of DNA describes the tendency for successive base pairs to be
   non-parallel in an additive manner over several base pair steps.
   Bending most commonly is produced by a rolling of adjacent base pairs
   over one another about thir long axis, although in principle, tilting
   of base pairs about their short axis could make a contribution. In
   contrast curvature of DNA represents the tendency of the helix axis to
   follow a non-linear pathway over an appreciable length, in a manner
   that contributes to macroscopic behaviour such as gel retardation or
   ease of cyclization into DNA minicircles.

   The distinction between local bending and macroscopic curvature is
   illustrated (poorly) in the following figure (see figure 1 of the
   Goodsell & Dickerson paper for a better view).
                       bend   bend   bend
                         -     -     -
  uncurved              / \   / \   / \
                  -----/   \-/   \-/   \-----
                          bend   bend




                    bend    bend
                     /-------\
                   /          \
  curved          |bend        |bend
                  |            |
                  |            |


   X-ray crystal structure analysis cannot show curvature, but can and
   often does show local bending. Conversely, gel electrophoresis and
   cyclization kinetics can detect macroscopic curvature, but not
   bending. A complete knowledge of local bending would permit the
   precise calculation of curvature, but a knowledge of macroscopic
   curvature alone does not allow one to specify precisely the local
   bending elements that produce it. This paradox has plagued the DNA
   conformation field resembles the familiar problem of classical
   statistical mechanics, where a complete knowledge of positions and
   velocities of all molecules of a gas would allow one to calculate bulk
   properties such as temperature, pressure and volume, but knowledge of
   bulk properties cannot lead one to precise molecular positions. Many
   molecular arrangements can produce identical bulk properties, and in
   the present case, many bending combinations can produce identical
   macroscopic curvature.

   The consensus sequence for DNA bending is 5 As and 5 non-As
   alternating. "N" is an ambiguity code for any base, and "B" is the
   ambiguity code for "not A" so "BANANA" is itself a bent sequence -
   hence the name of this program.

References

    1. Goodsell, D.S. & Dickerson, R.E. (1994) "Bending and Curvature
       Calculations in B-DNA" Nucl. Acids. Res. 22, 5497-5503.
    2. Drew and Travers (1986) JMB 191, 659

Warnings

   Only ACTG allowed, if sequence contains a non ACTG character then the
   program will exit with a fatal error message.

Diagnostic Error Messages

   None.

Exit status

   0 if successful.

Known bugs

   None.

See also

                    Program name                           Description
                    btwisted     Calculate the twisting in a B-DNA sequence
                    chaos        Draw a chaos game representation plot for a nucleotide sequence
                    compseq      Calculate the composition of unique words in sequences
                    dan          Calculates nucleic acid melting temperature
                    density      Draw a nucleic acid density plot
                    freak        Generate residue/base frequency table or plot
                    isochore     Plots isochores in DNA sequences
                    sirna        Finds siRNA duplexes in mRNA
                    wordcount    Count and extract unique words in DNA sequence(s)

Author(s)

   Ian              Longden (il  sanger.ac.uk)
   Sanger           Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge,
                    CB10 1SA, UK.

History

                    The original program ('BEND') is described in the Goodsell & Dickerson
   paper.           Created 1999/06/09.

Target users

                    This program is intended to be used by everyone and everything, from
                    naive users to embedded scripts.

Comments

                    None
